PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG449500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 28998.1 Da    PI: 8.7809
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG449500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.8e-32958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  Pavir.1KG449500.1.p  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                         79**********************************************95 PP

2K-box104.61.3e-3478171699
                K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                          +++ + ++++s++qe++kL+++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke+ l e n++L+
  Pavir.1KG449500.1.p  78 DSNGALSETQSWYQEMSKLRAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERHLGEMNRQLK 167
                          344466788********************************************************************************* PP

                K-box  96 kkle 99 
                          +kle
  Pavir.1KG449500.1.p 168 HKLE 171
                          **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.78E-46278No hitNo description
SuperFamilySSF554553.66E-33277IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-3085170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.8886176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA  60
GITKTLERYQ HCCYNAQDSN GALSETQSWY QEMSKLRAKF EALQRTQRHL LGEDLGPLSV  120
KELQQLEKQL ECALSQARQR KTQLMMEQVE ELRRKERHLG EMNRQLKHKL EAEGCSNYRT  180
LQHAAAWPAP GGTMVEHDGA TYHVHPPAPS AAMDCEPTLQ IGYPPHHQFL PSEVANNIPR  240
SAPGGENNFM LGWVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A1e-227917410104Developmental protein SEPALLATA 3
4ox0_B1e-227917410104Developmental protein SEPALLATA 3
4ox0_C1e-227917410104Developmental protein SEPALLATA 3
4ox0_D1e-227917410104Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353730.0BT035373.1 Zea mays full-length cDNA clone ZM_BFb0058A05 mRNA, complete cds.
GenBankMZEMADSA0.0L46397.1 Zea mays MADS-box protein (ZAG3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953459.10.0PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU391e-150MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLK3YV640.0K3YV64_SETIT; Uncharacterized protein
STRINGSi018160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-99AGAMOUS-like 6